| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-2 |
|---|
| Ligand | BDBM50575325 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2124825 (CHEMBL4834058) |
|---|
| Kd | 22000±n/a nM |
|---|
| Citation |  Gironda-Martínez, A; Gorre, ÉMD; Prati, L; Gosalbes, JF; Dakhel, S; Cazzamalli, S; Samain, F; Donckele, EJ; Neri, D Identification and Validation of New Interleukin-2 Ligands Using DNA-Encoded Libraries. J Med Chem64:17496-17510 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-2 |
|---|
| Name: | Interleukin-2 |
|---|
| Synonyms: | IL-2 | IL2 | IL2_HUMAN | INN=Aldesleukin | Interleukin-2 | Interleukin-2 (IL-2) | T-cell growth factor | TCGF |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 17630.05 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P60568 |
|---|
| Residue: | 153 |
|---|
| Sequence: | MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
|
|
|
|---|
| BDBM50575325 |
|---|
| n/a |
|---|
| Name | BDBM50575325 |
|---|
| Synonyms: | CHEMBL4867370 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H30N4O3 |
|---|
| Mol. Mass. | 446.5414 |
|---|
| SMILES | COC(=O)[C@H](Cc1ccc(cc1)C#Cc1ccccc1)NC(=O)C[C@@H]1CCCN(C1)C(N)=N |r| |
|---|
| Structure | 
|
|---|
Search and Browse
