| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-2 |
|---|
| Ligand | BDBM387297 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2124827 (CHEMBL4834060) |
|---|
| IC50 | 150±n/a nM |
|---|
| Citation |  Khedkar, NR; Irlapatti, NR; Dadke, D; Kanoje, V; Shaikh, Z; Karche, V; Shinde, V; Deshmukh, G; Patil, A; Jachak, S; Phukan, S; Kizhakinagath, PA; Gholve, M; Bhankhede, T; Daler, J; Nemade, HN; Budhe, S; Pareek, H; Yeshodharan, R; Gupta, R; Kalia, A; Pandey, D; Wagh, A; Kumar, S; Patil, V; Modi, D; Sharma, N; Ahirrao, P; Mehta, M; Kumar, H; Nigade, P; Tamane, K; Mallurwar, S; Kuldharan, S; Pawar, S; Vishwase, G; Bokan, S; Singh, M; Naik, K; Ingawale, S; Shankar, R; Kamalakannan, P; Venugopal, S; George, SK; Padiya, KJ; Nemmani, KVS; Gundu, J; Bhonde, M; Narasimham, L; Sindkhedkar, M; Shah, C; Sinha, N; Sharma, S; Bakhle, D; Kamboj, RK; Palle, VP Discovery of a Novel Potent and Selective Calcium Release-Activated Calcium Channel Inhibitor: 2,6-Difluoro- J Med Chem64:17004-17030 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-2 |
|---|
| Name: | Interleukin-2 |
|---|
| Synonyms: | IL-2 | IL2 | IL2_HUMAN | INN=Aldesleukin | Interleukin-2 | Interleukin-2 (IL-2) | T-cell growth factor | TCGF |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 17630.05 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P60568 |
|---|
| Residue: | 153 |
|---|
| Sequence: | MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
|
|
|
|---|
| BDBM387297 |
|---|
| n/a |
|---|
| Name | BDBM387297 |
|---|
| Synonyms: | US10292981, Example 121 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H18F2N4O3 |
|---|
| Mol. Mass. | 436.4108 |
|---|
| SMILES | Cc1ccc(cc1-c1cnc(cn1)C(=O)Nc1c(F)cccc1F)C1=NOC(C)(C)C1=O |t:27| |
|---|
| Structure | 
|
|---|
Search and Browse
