Reaction Details |
| Report a problem with these data |
Target | Hepatitis A virus cellular receptor 2 |
---|
Ligand | BDBM50579456 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2135392 (CHEMBL4845002) |
---|
Ki | 750±n/a nM |
---|
Citation | Rietz, TA; Teuscher, KB; Mills, JJ; Gogliotti, RD; Lepovitz, LT; Scaggs, WR; Yoshida, K; Luong, K; Lee, T; Fesik, SW Fragment-Based Discovery of Small Molecules Bound to T-Cell Immunoglobulin and Mucin Domain-Containing Molecule 3 (TIM-3). J Med Chem64:14757-14772 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Hepatitis A virus cellular receptor 2 |
---|
Name: | Hepatitis A virus cellular receptor 2 |
Synonyms: | CD_antigen=CD366 | HAVCR2 | HAVR2_HUMAN | HAVcr-2 | Hepatitis A virus cellular receptor 2 | T-cell immunoglobulin and mucin domain-containing protein 3 | T-cell immunoglobulin mucin receptor 3 | T-cell membrane protein 3 | TIM-3 | TIM3 | TIMD-3 | TIMD3 |
Type: | PROTEIN |
Mol. Mass.: | 33391.41 |
Organism: | Homo sapiens |
Description: | ChEMBL_119972 |
Residue: | 301 |
Sequence: | MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPV
FECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMND
EKFNLKLVIKPAKVTPAPTRQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLA
NELRDSRLANDLRDSGATIRIGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLI
SLANLPPSGLANAVAEGIRSEENIYTIEENVYEVEEPNEYYCYVSSRQQPSQPLGCRFAM
P
|
|
|
BDBM50579456 |
---|
n/a |
---|
Name | BDBM50579456 |
Synonyms: | CHEMBL4863017 |
Type | Small organic molecule |
Emp. Form. | C18H16ClN5O3S |
Mol. Mass. | 417.869 |
SMILES | Cc1nc2c3cc(c(Cl)cc3[nH]c(=O)n2n1)-c1ccc(NS(C)(=O)=O)cc1C |
Structure |
|