Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50580826 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2149053 (CHEMBL5033451) |
---|
Ki | 36±n/a nM |
---|
Citation | García, M; Llorente, V; Garriga, L; Christmann, U; Rodríguez-Escrich, S; Virgili, M; Fernández, B; Bordas, M; Ayet, E; Burgueño, J; Pujol, M; Dordal, A; Portillo-Salido, E; Gris, G; Vela, JM; Almansa, C Propionamide Derivatives as Dual ?-Opioid Receptor Agonists and ? J Med Chem64:10139-10154 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50580826 |
---|
n/a |
---|
Name | BDBM50580826 |
Synonyms: | CHEMBL5073189 |
Type | Small organic molecule |
Emp. Form. | C24H29F3N4O |
Mol. Mass. | 446.5085 |
SMILES | CCC(=O)N(CC1(CC1)N1CCN(Cc2ccccc2)CC1)c1ncccc1C(F)(F)F |
Structure |
|