| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50580830 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2149053 (CHEMBL5033451) |
|---|
| Ki | 21±n/a nM |
|---|
| Citation |  García, M; Llorente, V; Garriga, L; Christmann, U; Rodríguez-Escrich, S; Virgili, M; Fernández, B; Bordas, M; Ayet, E; Burgueño, J; Pujol, M; Dordal, A; Portillo-Salido, E; Gris, G; Vela, JM; Almansa, C Propionamide Derivatives as Dual ?-Opioid Receptor Agonists and ? J Med Chem64:10139-10154 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50580830 |
|---|
| n/a |
|---|
| Name | BDBM50580830 |
|---|
| Synonyms: | CHEMBL5070613 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H35N3O2 |
|---|
| Mol. Mass. | 421.575 |
|---|
| SMILES | CCC(=O)N(CC1(CCOCC1)N1CCN(Cc2ccccc2)CC1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
