Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50150797 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_305297 (CHEMBL832845) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Balboni, G; Salvadori, S; Guerrini, R; Negri, L; Giannini, E; Bryant, SD; Jinsmaa, Y; Lazarus, LH Direct influence of C-terminally substituted amino acids in the Dmt-Tic pharmacophore on delta-opioid receptor selectivity and antagonism. J Med Chem47:4066-71 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50150797 |
---|
n/a |
---|
Name | BDBM50150797 |
Synonyms: | 2-[2-Amino-3-((S)-4-hydroxy-2,6-dimethyl-phenyl)-propionyl]-1,2,3,4-tetrahydro-isoquinoline-3-carboxylic acid (1-carbamoyl-ethyl)-amide | CHEMBL359786 |
Type | Small organic molecule |
Emp. Form. | C24H30N4O4 |
Mol. Mass. | 438.5194 |
SMILES | C[C@H](NC(=O)C1Cc2ccccc2CN1C(=O)C(N)Cc1c(C)cc(O)cc1C)C(N)=O |
Structure |
|