Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Disintegrin and metalloproteinase domain-containing protein 17 |
---|
Ligand | BDBM50152909 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_305667 (CHEMBL827936) |
---|
IC50 | 1.8±n/a nM |
---|
Citation | Xue, CB; Chen, XT; He, X; Roderick, J; Corbett, RL; Ghavimi, B; Liu, RQ; Covington, MB; Qian, M; Ribadeneira, MD; Vaddi, K; Trzaskos, J; Newton, RC; Duan, JJ; Decicco, CP Synthesis and structure-activity relationship of a novel sulfone series of TNF-alpha converting enzyme inhibitors. Bioorg Med Chem Lett14:4453-9 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Disintegrin and metalloproteinase domain-containing protein 17 |
---|
Name: | Disintegrin and metalloproteinase domain-containing protein 17 |
Synonyms: | A disintegrin and metalloproteinase domain 17 | ADA17_PIG | ADAM 17 | ADAM17 | Snake venom-like protease | TACE | TNF-alpha-Converting Enzyme |
Type: | Metalloprotease |
Mol. Mass.: | 12197.99 |
Organism: | Sus scrofa (pig) |
Description: | Partially purified TACE was obtained from porcine spleen. |
Residue: | 112 |
Sequence: | MLREQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPIGK
KNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
|
|
|
BDBM50152909 |
---|
n/a |
---|
Name | BDBM50152909 |
Synonyms: | 1-Allyl-3-[4-(2-methyl-quinolin-4-ylmethoxy)-benzenesulfonylmethyl]-piperidine-4-carboxylic acid hydroxyamide | CHEMBL185159 |
Type | Small organic molecule |
Emp. Form. | C27H31N3O5S |
Mol. Mass. | 509.617 |
SMILES | Cc1cc(COc2ccc(cc2)S(=O)(=O)CC2CN(CC=C)CCC2C(=O)NO)c2ccccc2n1 |
Structure |
|