| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Ligand | BDBM50157223 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_306387 (CHEMBL828728) |
|---|
| IC50 | 116±n/a nM |
|---|
| Citation |  Ferrali, A; Menchi, G; Occhiato, EG; Danza, G; Mancina, R; Serio, M; Guarna, A Synthesis and activity of 8-substituted benzo[c]quinolizin-3-ones as dual inhibitors of human 5alpha-reductases 1 and 2. Bioorg Med Chem Lett15:145-8 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 | 5α-Reductase 1 (5α-R1) | S5A1_HUMAN | S5AR | SR type 1 | SRD5A1 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 29472.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P18405 |
|---|
| Residue: | 259 |
|---|
| Sequence: | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
|
|
|
|---|
| BDBM50157223 |
|---|
| n/a |
|---|
| Name | BDBM50157223 |
|---|
| Synonyms: | 4-Methyl-3-oxo-2,3,5,6-tetrahydro-1H-pyrido[1,2-a]quinoline-8-carboxylic acid 4-methoxy-phenyl ester | CHEMBL182787 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H21NO4 |
|---|
| Mol. Mass. | 363.4064 |
|---|
| SMILES | COc1ccc(OC(=O)c2ccc3N4CCC(=O)C(C)=C4CCc3c2)cc1 |c:19| |
|---|
| Structure | 
|
|---|
Search and Browse
