Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Interleukin-2 |
---|
Ligand | BDBM50587595 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2173332 (CHEMBL5058466) |
---|
IC50 | 304±n/a nM |
---|
Citation | Abdel-Magid, AF Dual Inhibition of IL-2-Inducible T-Cell Kinase (ITK) and Tropomyosin Receptor Kinase A (TRKA) as Potential Treatment for Atopic Dermatitis and Other Inflammatory and Autoimmune Diseases. ACS Med Chem Lett12:1889-1891 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Interleukin-2 |
---|
Name: | Interleukin-2 |
Synonyms: | IL-2 | IL2 | IL2_HUMAN | INN=Aldesleukin | Interleukin-2 | Interleukin-2 (IL-2) | T-cell growth factor | TCGF |
Type: | Enzyme |
Mol. Mass.: | 17630.05 |
Organism: | Homo sapiens (Human) |
Description: | P60568 |
Residue: | 153 |
Sequence: | MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
|
|
|
BDBM50587595 |
---|
n/a |
---|
Name | BDBM50587595 |
Synonyms: | CHEMBL5083169 | US11661419, Example 23 | US20230280220, Example 23 |
Type | Small organic molecule |
Emp. Form. | C24H27FN6O3 |
Mol. Mass. | 466.508 |
SMILES | [H][C@@]12C[C@]1(C)Cc1[nH]nc(c1C2)-c1nc2cc(cc(F)c2[nH]1)N(C)C(=O)[C@@H](C)N1CCOCC1=O |r| |
Structure |
|