Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50162315 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_305461 (CHEMBL830957) |
---|
IC50 | 17±n/a nM |
---|
Citation | Gangjee, A; Lin, X CoMFA and CoMSIA analyses of Pneumocystis carinii dihydrofolate reductase, Toxoplasma gondii dihydrofolate reductase, and rat liver dihydrofolate reductase. J Med Chem48:1448-69 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 21638.84 |
Organism: | Rattus norvegicus (rat) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50162315 |
---|
n/a |
---|
Name | BDBM50162315 |
Synonyms: | CHEMBL367802 | N*6*-Methyl-N*6*-naphthalen-1-ylmethyl-quinazoline-2,4,6-triamine |
Type | Small organic molecule |
Emp. Form. | C20H19N5 |
Mol. Mass. | 329.3984 |
SMILES | CN(Cc1cccc2ccccc12)c1ccc2nc(N)nc(N)c2c1 |
Structure |
|