| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ribonuclease pancreatic |
|---|
| Ligand | BDBM50590723 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2197638 (CHEMBL5110154) |
|---|
| Ki | 29000±n/a nM |
|---|
| Citation |  Das, A; Dasgupta, S; Pathak, T Crescent-shaped meta-substituted benzene derivatives as a new class of non-nucleoside ribonuclease A inhibitors. Bioorg Med Chem71:0 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ribonuclease pancreatic |
|---|
| Name: | Ribonuclease pancreatic |
|---|
| Synonyms: | CAM-RNase A | RNAS1_BOVIN | RNASE1 | RNAse A | RNS1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 16468.79 |
|---|
| Organism: | Bison bison (American bison) |
|---|
| Description: | carboxamidomethylated RNase A |
|---|
| Residue: | 150 |
|---|
| Sequence: | MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRN
LTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPN
CAYKTTQANKHIIVACEGNPYVPVHFDASV
|
|
|
|---|
| BDBM50590723 |
|---|
| n/a |
|---|
| Name | BDBM50590723 |
|---|
| Synonyms: | CHEMBL5174669 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H22N6O10S2 |
|---|
| Mol. Mass. | 498.489 |
|---|
| SMILES | O[C@H]1[C@H](COCc2cn(CCS(O)(=O)=O)nn2)O[C@H](Cn2cc(CS(O)(=O)=O)nn2)[C@H]1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
