| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Galectin-1 |
|---|
| Ligand | BDBM50591132 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2199440 (CHEMBL5111956) |
|---|
| Kd | 3170±n/a nM |
|---|
| Citation |  Zetterberg, FR; MacKinnon, A; Brimert, T; Gravelle, L; Johnsson, RE; Kahl-Knutson, B; Leffler, H; Nilsson, UJ; Pedersen, A; Peterson, K; Roper, JA; Schambye, H; Slack, RJ; Tantawi, S Discovery and Optimization of the First Highly Effective and Orally Available Galectin-3 Inhibitors for Treatment of Fibrotic Disease. J Med Chem65:12626-12638 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Galectin-1 |
|---|
| Name: | Galectin-1 |
|---|
| Synonyms: | 14 kDa lectin | Beta-galactoside-binding lectin L-14-I | Gal-1 | Galaptin | Galectin-1 | LEG1_RAT | Lactose-binding lectin 1 | Lectin galactoside-binding soluble 1 | Lgals1 | RL 14.5 | S-Lac lectin 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 14853.16 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_118933 |
|---|
| Residue: | 135 |
|---|
| Sequence: | MACGLVASNLNLKPGECLKVRGELAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNSKDDGTWGTEQRETAFPFQPGSITEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINY
MAADGDFKIKCVAFE
|
|
|
|---|
| BDBM50591132 |
|---|
| n/a |
|---|
| Name | BDBM50591132 |
|---|
| Synonyms: | CHEMBL5182222 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H16BrF3N4O4S |
|---|
| Mol. Mass. | 533.319 |
|---|
| SMILES | OC[C@H]1O[C@H](Sc2cncc(Br)c2)[C@H](O)[C@H]([C@H]1O)n1cc(nn1)-c1cc(F)c(F)c(F)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
