Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Galectin-3 |
---|
Ligand | BDBM50591132 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2199449 (CHEMBL5111965) |
---|
Kd | 770±n/a nM |
---|
Citation | Zetterberg, FR; MacKinnon, A; Brimert, T; Gravelle, L; Johnsson, RE; Kahl-Knutson, B; Leffler, H; Nilsson, UJ; Pedersen, A; Peterson, K; Roper, JA; Schambye, H; Slack, RJ; Tantawi, S Discovery and Optimization of the First Highly Effective and Orally Available Galectin-3 Inhibitors for Treatment of Fibrotic Disease. J Med Chem65:12626-12638 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Galectin-3 |
---|
Name: | Galectin-3 |
Synonyms: | LEG3_MOUSE | Lgals3 |
Type: | PROTEIN |
Mol. Mass.: | 27519.08 |
Organism: | Mus musculus |
Description: | ChEMBL_302220 |
Residue: | 264 |
Sequence: | MADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPG
AYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGP
YGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN
NRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMK
NLREISQLGISGDITLTSANHAMI
|
|
|
BDBM50591132 |
---|
n/a |
---|
Name | BDBM50591132 |
Synonyms: | CHEMBL5182222 |
Type | Small organic molecule |
Emp. Form. | C19H16BrF3N4O4S |
Mol. Mass. | 533.319 |
SMILES | OC[C@H]1O[C@H](Sc2cncc(Br)c2)[C@H](O)[C@H]([C@H]1O)n1cc(nn1)-c1cc(F)c(F)c(F)c1 |r| |
Structure |
|