| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Galectin-3 |
|---|
| Ligand | BDBM50591132 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2199449 (CHEMBL5111965) |
|---|
| Kd | 770±n/a nM |
|---|
| Citation |  Zetterberg, FR; MacKinnon, A; Brimert, T; Gravelle, L; Johnsson, RE; Kahl-Knutson, B; Leffler, H; Nilsson, UJ; Pedersen, A; Peterson, K; Roper, JA; Schambye, H; Slack, RJ; Tantawi, S Discovery and Optimization of the First Highly Effective and Orally Available Galectin-3 Inhibitors for Treatment of Fibrotic Disease. J Med Chem65:12626-12638 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Galectin-3 |
|---|
| Name: | Galectin-3 |
|---|
| Synonyms: | LEG3_MOUSE | Lgals3 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27519.08 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_302220 |
|---|
| Residue: | 264 |
|---|
| Sequence: | MADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPG
AYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGP
YGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN
NRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMK
NLREISQLGISGDITLTSANHAMI
|
|
|
|---|
| BDBM50591132 |
|---|
| n/a |
|---|
| Name | BDBM50591132 |
|---|
| Synonyms: | CHEMBL5182222 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H16BrF3N4O4S |
|---|
| Mol. Mass. | 533.319 |
|---|
| SMILES | OC[C@H]1O[C@H](Sc2cncc(Br)c2)[C@H](O)[C@H]([C@H]1O)n1cc(nn1)-c1cc(F)c(F)c(F)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
