| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocortin receptor 5 |
|---|
| Ligand | BDBM50592979 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2206712 (CHEMBL5119420) |
|---|
| Ki | 28.8±n/a nM |
|---|
| Citation |  Reynaud, S; Laurin, SA; Ciolek, J; Barbe, P; Van Baelen, AC; Susset, M; Blondel, F; Ghazarian, M; Boeri, J; Vanden Driessche, M; Upert, G; Mourier, G; Kessler, P; Konnert, L; Beroud, R; Keck, M; Servent, D; Bouvier, M; Gilles, N From a Cone Snail Toxin to a Competitive MC4R Antagonist. J Med Chem65:12084-12094 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocortin receptor 5 |
|---|
| Name: | Melanocortin receptor 5 |
|---|
| Synonyms: | MC-2 | MC5-R | MC5R | MC5R_HUMAN | Melanocortin MC5 | Melanocortin receptor (M4 and M5) | Melanocortin receptor 5 | Melanocortin receptor 5 (MC5R) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36612.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P33032 |
|---|
| Residue: | 325 |
|---|
| Sequence: | MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
|
|
|
|---|
| BDBM50592979 |
|---|
| n/a |
|---|
| Name | BDBM50592979 |
|---|
| Synonyms: | CHEMBL5192562 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C138H198N36O30S4 |
|---|
| Mol. Mass. | 2969.532 |
|---|
| SMILES | [H][C@@]12CCCN1C(=O)[C@]1([H])CCCN1C(=O)[C@@H]1CSSC[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](Cc3ccccc3)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc3ccccc3)NC(=O)CNC2=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc2ccccc2)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N2CCC[C@H]2C(=O)N2CCC[C@H]2C(O)=O)NC(=O)[C@H](Cc2ccc(O)cc2)NC(=O)[C@H](Cc2c[nH]cn2)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](N)CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N1 |
|---|
| Structure | 
|
|---|
Search and Browse
