| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Type-2 angiotensin II receptor |
|---|
| Ligand | BDBM50156173 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2211253 (CHEMBL5124202) |
|---|
| Ki | 0.400000±n/a nM |
|---|
| Citation |  Gopalan, G; Palo-Nieto, C; Petersen, NN; Hallberg, M; Larhed, M Angiotensin II AT2 receptor ligands with phenylthiazole scaffolds. Bioorg Med Chem65:0 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Type-2 angiotensin II receptor |
|---|
| Name: | Type-2 angiotensin II receptor |
|---|
| Synonyms: | Angiotensin type II receptor |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 15474.49 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | ChEMBL_1285617 |
|---|
| Residue: | 137 |
|---|
| Sequence: | MAFPPEKYAQWSAGIALMKNILGFIIPLVFIATCYFGIRKHLLKTNSYGKNRITRDQVLN
MAAAVVLAFIICWLPFHVLTFLDALAWMGIINSCEVIAVIDLALPFAILLGFTNSCINPF
LYCFVGNRFQQKLRSVF
|
|
|
|---|
| BDBM50156173 |
|---|
| n/a |
|---|
| Name | BDBM50156173 |
|---|
| Synonyms: | (1-((2'-(1H-tetrazol-5-yl)biphenyl-4-yl)methyl)-2-butyl-4-chloro-1H-imidazol-5-yl)methanol | CHEMBL189568 | butyl (5-isobutylthien-2-yl)sulfonylcarbamate derivative | butyl 3-(4-((1H-imidazol-1-yl)methyl)phenyl)-5-isobutylthiophen-2-ylsulfonylcarbamate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H29N3O4S2 |
|---|
| Mol. Mass. | 475.624 |
|---|
| SMILES | CCCCOC(=O)NS(=O)(=O)c1sc(CC(C)C)cc1-c1ccc(Cn2ccnc2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
