Reaction Details |
| Report a problem with these data |
Target | Methionine aminopeptidase |
---|
Ligand | BDBM50175425 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_326947 (CHEMBL853289) |
---|
IC50 | 5780±n/a nM |
---|
Citation | Huang, QQ; Huang, M; Nan, FJ; Ye, QZ Metalloform-selective inhibition: synthesis and structure-activity analysis of Mn(II)-form-selective inhibitors of Escherichia coli methionine aminopeptidase. Bioorg Med Chem Lett15:5386-91 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Methionine aminopeptidase |
---|
Name: | Methionine aminopeptidase |
Synonyms: | EcMetAP | MAP1_ECOLI | Methionine Aminopeptidase (MAP) | Methionine aminopeptidase | Peptidase M | map |
Type: | Enzyme |
Mol. Mass.: | 29326.96 |
Organism: | Escherichia coli (strain K12) |
Description: | Full-length untagged EcMAP was expressed in E. coli. |
Residue: | 264 |
Sequence: | MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACL
GYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTI
MGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEE
PQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVV
TDNGCEILTLRKDDTIPAIISHDE
|
|
|
BDBM50175425 |
---|
n/a |
---|
Name | BDBM50175425 |
Synonyms: | 5-(2-chlorophenyl)furan-2-carbohydrazide | CHEMBL200849 |
Type | Small organic molecule |
Emp. Form. | C11H9ClN2O2 |
Mol. Mass. | 236.654 |
SMILES | NNC(=O)c1ccc(o1)-c1ccccc1Cl |
Structure |
|