Reaction Details |
| Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM50603207 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2243444 (CHEMBL5157654) |
---|
Ki | 171±n/a nM |
---|
Citation | Jonas, H; Aiello, D; Schepmann, D; Diana, P; Wünsch, B Synthesis of 8-aminomorphans with high KOR affinity. Eur J Med Chem230:0 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20953.88 |
Organism: | Rattus norvegicus (Rat) |
Description: | Q5U3Y7 |
Residue: | 176 |
Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
BDBM50603207 |
---|
n/a |
---|
Name | BDBM50603207 |
Synonyms: | CHEMBL5185196 |
Type | Small organic molecule |
Emp. Form. | C19H24Cl2N2O |
Mol. Mass. | 367.313 |
SMILES | [H][C@@]12C[C@H](N3CCCC3)[C@@]([H])(C1)N(CC2)C(=O)Cc1ccc(Cl)c(Cl)c1 |r,THB:4:3:12.13.14:11,15:12:11:3.2| |
Structure |
|