| Reaction Details |
|---|
 | Report a problem with these data |
| Target | fMet-Leu-Phe receptor |
|---|
| Ligand | BDBM50604086 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2246779 (CHEMBL5160989) |
|---|
| EC50 | 6800±n/a nM |
|---|
| Citation |  Mastromarino, M; Favia, M; Schepetkin, IA; Kirpotina, LN; Trojan, E; Niso, M; Carrieri, A; Le?kiewicz, M; Regulska, M; Darida, M; Rossignolo, F; Fontana, S; Quinn, MT; Basta-Kaim, A; Leopoldo, M; Lacivita, E Design, Synthesis, Biological Evaluation, and Computational Studies of Novel Ureidopropanamides as Formyl Peptide Receptor 2 (FPR2) Agonists to Target the Resolution of Inflammation in Central Nervous System Disorders. J Med Chem65:5004-5028 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| fMet-Leu-Phe receptor |
|---|
| Name: | fMet-Leu-Phe receptor |
|---|
| Synonyms: | FPR | FPR1 | FPR1_HUMAN | Formyl peptide Receptor | N-formyl peptide receptor 1 | N-formylpeptide chemoattractant receptor | fMLP receptor | fMet-Leu-Phe receptor | formyl peptide receptor 1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 38456.14 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_4503779 |
|---|
| Residue: | 350 |
|---|
| Sequence: | METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVT
TISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIA
LDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNF
SPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPL
RVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML
YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
|
|
|
|---|
| BDBM50604086 |
|---|
| n/a |
|---|
| Name | BDBM50604086 |
|---|
| Synonyms: | CHEMBL5170711 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H23FN4O2 |
|---|
| Mol. Mass. | 442.4848 |
|---|
| SMILES | Fc1ccc(NC(=O)N[C@H](Cc2ccc(cc2)C#N)C(=O)N2CCc3ccccc3C2)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
