Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | N-formyl peptide receptor 2 |
---|
Ligand | BDBM50604076 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2246782 (CHEMBL5160992) |
---|
IC50 | 3800±n/a nM |
---|
Citation | Mastromarino, M; Favia, M; Schepetkin, IA; Kirpotina, LN; Trojan, E; Niso, M; Carrieri, A; Le?kiewicz, M; Regulska, M; Darida, M; Rossignolo, F; Fontana, S; Quinn, MT; Basta-Kaim, A; Leopoldo, M; Lacivita, E Design, Synthesis, Biological Evaluation, and Computational Studies of Novel Ureidopropanamides as Formyl Peptide Receptor 2 (FPR2) Agonists to Target the Resolution of Inflammation in Central Nervous System Disorders. J Med Chem65:5004-5028 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
N-formyl peptide receptor 2 |
---|
Name: | N-formyl peptide receptor 2 |
Synonyms: | ALXR, FPRL1, FPR2 | FMLP-related receptor I FMLP-R-I | FPR2 | FPR2_HUMAN | FPRH1 | FPRL1 | Formyl Peptide Receptor-Like 1 | HM63 | LXA4 receptor | LXA4R | Lipoxin A4 receptor | Lipoxin A4 receptor (LXA4) | RFP | hFPRL |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 38968.35 |
Organism: | Homo sapiens (Human) |
Description: | P25090 |
Residue: | 351 |
Sequence: | METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
|
|
|
BDBM50604076 |
---|
n/a |
---|
Name | BDBM50604076 |
Synonyms: | CHEMBL5176452 |
Type | Small organic molecule |
Emp. Form. | C23H24FN5O3 |
Mol. Mass. | 437.4668 |
SMILES | Fc1ccc(NC(=O)N[C@H](Cc2ccc(cc2)C#N)C(=O)NC2CCCCNC2=O)cc1 |r| |
Structure |
|