Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | fMet-Leu-Phe receptor |
---|
Ligand | BDBM50604080 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2246783 (CHEMBL5160993) |
---|
IC50 | 43900±n/a nM |
---|
Citation | Mastromarino, M; Favia, M; Schepetkin, IA; Kirpotina, LN; Trojan, E; Niso, M; Carrieri, A; Le?kiewicz, M; Regulska, M; Darida, M; Rossignolo, F; Fontana, S; Quinn, MT; Basta-Kaim, A; Leopoldo, M; Lacivita, E Design, Synthesis, Biological Evaluation, and Computational Studies of Novel Ureidopropanamides as Formyl Peptide Receptor 2 (FPR2) Agonists to Target the Resolution of Inflammation in Central Nervous System Disorders. J Med Chem65:5004-5028 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
fMet-Leu-Phe receptor |
---|
Name: | fMet-Leu-Phe receptor |
Synonyms: | FPR | FPR1 | FPR1_HUMAN | Formyl peptide Receptor | N-formyl peptide receptor 1 | N-formylpeptide chemoattractant receptor | fMLP receptor | fMet-Leu-Phe receptor | formyl peptide receptor 1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 38456.14 |
Organism: | Homo sapiens (Human) |
Description: | gi_4503779 |
Residue: | 350 |
Sequence: | METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVT
TISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIA
LDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNF
SPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPL
RVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML
YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
|
|
|
BDBM50604080 |
---|
n/a |
---|
Name | BDBM50604080 |
Synonyms: | CHEMBL5184396 |
Type | Small organic molecule |
Emp. Form. | C21H21FN4O2 |
Mol. Mass. | 380.4154 |
SMILES | Fc1ccc(NC(=O)N[C@H](Cc2ccc(cc2)C#N)C(=O)N2CCCC2)cc1 |r| |
Structure |
|