Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Proteasome subunit beta type-8 |
---|
Ligand | BDBM50604327 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2247504 (CHEMBL5161714) |
---|
IC50 | 1.7±n/a nM |
---|
Citation | Nan, G; Huang, L; Li, Y; Yang, Y; Yang, Y; Li, K; Lai, F; Chen, X; Xiao, Z Identification of N, C-capped di- and tripeptides as selective immunoproteasome inhibitors. Eur J Med Chem234:0 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-8 |
---|
Name: | Proteasome subunit beta type-8 |
Synonyms: | 26S proteosome | LMP7 | Low molecular mass protein 7 | Macropain subunit C13 | Multicatalytic endopeptidase complex subunit C13 | PSB8_HUMAN | PSMB5i | PSMB8 | Proteasome component C13 | Proteasome subunit beta type-8 | Proteasome subunit beta-5i | RING10 | Y2 |
Type: | PROTEIN |
Mol. Mass.: | 30357.49 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1446797 |
Residue: | 276 |
Sequence: | MALLDVCGAPRGQRPESALPVAGSGRRSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGD
GERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGC
AADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKG
PGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDS
YSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
|
|
|
BDBM50604327 |
---|
n/a |
---|
Name | BDBM50604327 |
Synonyms: | CHEMBL5202276 |
Type | Small organic molecule |
Emp. Form. | C46H47ClN6O5 |
Mol. Mass. | 799.356 |
SMILES | CC(C)(C)NC(=O)CC[C@H](NC(=O)CCNC(=O)C(=C\c1ccc(Cl)cc1)\C#N)C(=O)N[C@@H](Cc1ccc2ccccc2c1)C(=O)NCc1cccc2ccccc12 |r| |
Structure |
|