Reaction Details |
| Report a problem with these data |
Target | Proteasome subunit beta type-5 |
---|
Ligand | BDBM50604287 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2247505 (CHEMBL5161715) |
---|
IC50 | 9.5±n/a nM |
---|
Citation | Nan, G; Huang, L; Li, Y; Yang, Y; Yang, Y; Li, K; Lai, F; Chen, X; Xiao, Z Identification of N, C-capped di- and tripeptides as selective immunoproteasome inhibitors. Eur J Med Chem234:0 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-5 |
---|
Name: | Proteasome subunit beta type-5 |
Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
Type: | Protein |
Mol. Mass.: | 28480.96 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 263 |
Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
BDBM50604287 |
---|
n/a |
---|
Name | BDBM50604287 |
Synonyms: | CHEMBL5201806 |
Type | Small organic molecule |
Emp. Form. | C41H53ClN6O6 |
Mol. Mass. | 761.349 |
SMILES | Cc1ccc(CNC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CCC(=O)NC(C)(C)C)NC(=O)[C@H](CNC(=O)CCl)NC(=O)CCCc2ccccc2)cc1 |r| |
Structure |
|