| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50605927 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2253199 (CHEMBL5167409) |
|---|
| Ki | 271±n/a nM |
|---|
| Citation |  Sharma, S; Peng, Q; Vadukoot, AK; Aretz, CD; Jensen, AA; Wallick, AI; Dong, X; Hopkins, CR Synthesis and Biological Characterization of a Series of 2-Sulfonamidebenzamides as Allosteric Modulators of MrgX1. ACS Med Chem Lett13:841-847 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM50605927 |
|---|
| n/a |
|---|
| Name | BDBM50605927 |
|---|
| Synonyms: | CHEMBL5172913 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H19FN2O4S |
|---|
| Mol. Mass. | 378.418 |
|---|
| SMILES | CCOc1ccc(F)cc1NC(=O)c1ccccc1NS(=O)(=O)C1CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
