| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
|---|
| Ligand | BDBM8739 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2271340 |
|---|
| IC50 | 6440±n/a nM |
|---|
| Citation |  Rana, P; Ghouse, SM; Akunuri, R; Madhavi, YV; Chopra, S; Nanduri, S FabI (enoyl acyl carrier protein reductase) - A potential broad spectrum therapeutic target and its inhibitors. Eur J Med Chem208:0 (2020) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
|---|
| Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
|---|
| Synonyms: | Enoyl - (acyl carrier protein) reductase | Enoyl-ACP Reductase (FabI) | Enoyl-[acyl-carrier-protein] reductase | Enoyl-acyl carrier protein reductase (FabI) | FABI_ECOLI | NADH-dependent enoyl-ACP reductase | envM | fabI |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 27861.12 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 262 |
|---|
| Sequence: | MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
|
|
|
|---|
| BDBM8739 |
|---|
| n/a |
|---|
| Name | BDBM8739 |
|---|
| Synonyms: | 4-(4-methoxyphenyl)-1-[(4-methylphenyl)methyl]-1H-imidazole | Disubstituted imidazole 4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H18N2O |
|---|
| Mol. Mass. | 278.3483 |
|---|
| SMILES | COc1ccc(cc1)-c1cn(Cc2ccc(C)cc2)cn1 |
|---|
| Structure | 
|
|---|
Search and Browse
