Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
---|
Ligand | BDBM50481811 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2271340 |
---|
IC50 | 430±n/a nM |
---|
Citation | Rana, P; Ghouse, SM; Akunuri, R; Madhavi, YV; Chopra, S; Nanduri, S FabI (enoyl acyl carrier protein reductase) - A potential broad spectrum therapeutic target and its inhibitors. Eur J Med Chem208:0 (2020) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
---|
Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
Synonyms: | Enoyl - (acyl carrier protein) reductase | Enoyl-ACP Reductase (FabI) | Enoyl-[acyl-carrier-protein] reductase | Enoyl-acyl carrier protein reductase (FabI) | FABI_ECOLI | NADH-dependent enoyl-ACP reductase | envM | fabI |
Type: | Enzyme |
Mol. Mass.: | 27861.12 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 262 |
Sequence: | MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
|
|
|
BDBM50481811 |
---|
n/a |
---|
Name | BDBM50481811 |
Synonyms: | CHEMBL5268765 |
Type | Small organic molecule |
Emp. Form. | C19H14BrCl2NO2 |
Mol. Mass. | 439.13 |
SMILES | OC(c1c(Cl)cccc1Cl)c1cn(Cc2cccc(Br)c2)ccc1=O |
Structure |
|