Reaction Details |
| Report a problem with these data |
Target | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
---|
Ligand | BDBM50399407 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2271376 |
---|
IC50 | 58±n/a nM |
---|
Citation | Rana, P; Ghouse, SM; Akunuri, R; Madhavi, YV; Chopra, S; Nanduri, S FabI (enoyl acyl carrier protein reductase) - A potential broad spectrum therapeutic target and its inhibitors. Eur J Med Chem208:0 (2020) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
---|
Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
Synonyms: | Enoyl - (acyl carrier protein) reductase | Enoyl-ACP Reductase (FabI) | Enoyl-[acyl-carrier-protein] reductase | Enoyl-acyl carrier protein reductase (FabI) | FABI_ECOLI | NADH-dependent enoyl-ACP reductase | envM | fabI |
Type: | Enzyme |
Mol. Mass.: | 27861.12 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 262 |
Sequence: | MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
|
|
|
BDBM50399407 |
---|
n/a |
---|
Name | BDBM50399407 |
Synonyms: | CHEMBL2178284 | MUT056399 |
Type | Small organic molecule |
Emp. Form. | C15H13F2NO3 |
Mol. Mass. | 293.2654 |
SMILES | CCc1cc(O)c(Oc2ccc(cc2F)C(N)=O)cc1F |
Structure |
|