| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50481432 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2292353 |
|---|
| IC50 | 30000±n/a nM |
|---|
| Citation |  Ghosh, AK; Osswald, HL; Prato, G Recent Progress in the Development of HIV-1 Protease Inhibitors for the Treatment of HIV/AIDS. J Med Chem59:5172-208 (2016) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50481432 |
|---|
| n/a |
|---|
| Name | BDBM50481432 |
|---|
| Synonyms: | CHEMBL597982 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H41N3O4S |
|---|
| Mol. Mass. | 527.719 |
|---|
| SMILES | [H][C@@]12CCCC[C@]1([H])CN(C[C@@H](O)[C@@H](NC(=O)c1cccc(O)c1C)c1cccs1)[C@@H](C2)C(=O)NC(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
