| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase B |
|---|
| Ligand | BDBM92913 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2292745 |
|---|
| IC50 | 12000±n/a nM |
|---|
| Citation |  Dunyak, BM; Gestwicki, JE Peptidyl-Proline Isomerases (PPIases): Targets for Natural Products and Natural Product-Inspired Compounds. J Med Chem59:9622-9644 (2016) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase B |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase B |
|---|
| Synonyms: | CYP-S1 | CYPB | Cyclophilin B | Cyclophilin B (CypB) | PPIB | PPIB_HUMAN | PPIase | Peptidyl-prolyl cis-trans isomerase B | Rotamase | S-cyclophilin | SCYLP |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23751.82 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P23284 |
|---|
| Residue: | 216 |
|---|
| Sequence: | MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRV
IFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG
ERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVR
KVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE
|
|
|
|---|
| BDBM92913 |
|---|
| n/a |
|---|
| Name | BDBM92913 |
|---|
| Synonyms: | Aryl 1-indanylketone, 2 |
|---|
| Type | Small molecule |
|---|
| Emp. Form. | C22H18FNO3 |
|---|
| Mol. Mass. | 363.3816 |
|---|
| SMILES | Nc1cc(F)cc(-c2ccc(O)c(c2)C(=O)C2CCc3ccccc23)c1O |
|---|
| Structure | 
|
|---|
Search and Browse
