Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50614424 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2297012 |
---|
IC50 | 0.010000±n/a nM |
---|
Citation | Hassan, MZ; Osman, H; Ali, MA; Ahsan, MJ Therapeutic potential of coumarins as antiviral agents. Eur J Med Chem123:236-255 (2016) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50614424 |
---|
n/a |
---|
Name | BDBM50614424 |
Synonyms: | CHEMBL478728 |
Type | Small organic molecule |
Emp. Form. | C22H19NO8 |
Mol. Mass. | 425.3882 |
SMILES | CCOC(=O)C(C(c1cccc(c1)[N+]([O-])=O)c1c(O)c2ccccc2oc1=O)C(C)=O |
Structure |
|