Reaction Details |
| Report a problem with these data |
Target | B1 bradykinin receptor |
---|
Ligand | BDBM50202415 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_423668 (CHEMBL913433) |
---|
Ki | 11.6±n/a nM |
---|
Citation | Kuduk, SD; Di Marco, CN; Chang, RK; Wood, MR; Schirripa, KM; Kim, JJ; Wai, JM; DiPardo, RM; Murphy, KL; Ransom, RW; Harrell, CM; Reiss, DR; Holahan, MA; Cook, J; Hess, JF; Sain, N; Urban, MO; Tang, C; Prueksaritanont, T; Pettibone, DJ; Bock, MG Development of orally bioavailable and CNS penetrant biphenylaminocyclopropane carboxamide bradykinin B1 receptor antagonists. J Med Chem50:272-82 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
B1 bradykinin receptor |
---|
Name: | B1 bradykinin receptor |
Synonyms: | B1 BRADYKININ | B1 bradykinin receptor | B1R | BDKRB1 | BK-1 receptor | BKRB1_HUMAN | BRADYB1 | Bradykinin B1 receptor |
Type: | Enzyme |
Mol. Mass.: | 40508.87 |
Organism: | Homo sapiens (Human) |
Description: | P46663 |
Residue: | 353 |
Sequence: | MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
|
|
|
BDBM50202415 |
---|
n/a |
---|
Name | BDBM50202415 |
Synonyms: | CHEMBL387331 | methyl 4'-[({[1-(acetylamino)cyclopropyl]carbonyl}amino)-methyl]-3,3'-difluoro-1,1'-biphenyl-2-carboxylate |
Type | Small organic molecule |
Emp. Form. | C21H20F2N2O4 |
Mol. Mass. | 402.3913 |
SMILES | COC(=O)c1c(F)cccc1-c1ccc(CNC(=O)C2(CC2)NC(C)=O)c(F)c1 |
Structure |
|