| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Galectin-2 |
|---|
| Ligand | BDBM50243731 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_491862 (CHEMBL946199) |
|---|
| Kd | >4000000±n/a nM |
|---|
| Citation |  Oberg, CT; Blanchard, H; Leffler, H; Nilsson, UJ Protein subtype-targeting through ligand epimerization: talose-selectivity of galectin-4 and galectin-8. Bioorg Med Chem Lett18:3691-4 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Galectin-2 |
|---|
| Name: | Galectin-2 |
|---|
| Synonyms: | LEG2_HUMAN | LGALS2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 14643.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_491862 |
|---|
| Residue: | 132 |
|---|
| Sequence: | MTGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSL
DGSNWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVR
GGFNMSSFKLKE
|
|
|
|---|
| BDBM50243731 |
|---|
| n/a |
|---|
| Name | BDBM50243731 |
|---|
| Synonyms: | (2R,3S,4S,5S,6R)-3-acetoxy-5-hydroxy-6-(hydroxymethyl)-2-methoxy-tetrahydro-2H-pyran-4-yl 4-methylbenzoate | CHEMBL471376 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H22O8 |
|---|
| Mol. Mass. | 354.3518 |
|---|
| SMILES | CO[C@@H]1O[C@H](CO)[C@H](O)[C@H](OC(=O)c2ccc(C)cc2)[C@@H]1OC(C)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
