| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Ligand | BDBM50265114 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_492682 (CHEMBL953112) |
|---|
| Ki | 2.8±n/a nM |
|---|
| Citation |  Georgiadis, D; Yiotakis, A Specific targeting of metzincin family members with small-molecule inhibitors: progress toward a multifarious challenge. Bioorg Med Chem16:8781-94 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Name: | Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Synonyms: | A disintegrin and metalloproteinase domain 17 | ADA17_PIG | ADAM 17 | ADAM17 | Snake venom-like protease | TACE | TNF-alpha-Converting Enzyme |
|---|
| Type: | Metalloprotease |
|---|
| Mol. Mass.: | 12197.99 |
|---|
| Organism: | Sus scrofa (pig) |
|---|
| Description: | Partially purified TACE was obtained from porcine spleen. |
|---|
| Residue: | 112 |
|---|
| Sequence: | MLREQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPIGK
KNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
|
|
|
|---|
| BDBM50265114 |
|---|
| n/a |
|---|
| Name | BDBM50265114 |
|---|
| Synonyms: | CHEMBL495502 | N-((2R,6S)-4-(2-(hydroxyamino)-2-oxoethyl)-2,6-dimethylpiperidin-4-yl)-4-((2-methylquinolin-4-yl)methoxy)benzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H32N4O4 |
|---|
| Mol. Mass. | 476.5674 |
|---|
| SMILES | C[C@H]1C[C@](CC(=O)NO)(C[C@@H](C)N1)NC(=O)c1ccc(OCc2cc(C)nc3ccccc23)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
