Reaction Details |
| Report a problem with these data |
Target | Disintegrin and metalloproteinase domain-containing protein 17 |
---|
Ligand | BDBM50265114 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_492682 (CHEMBL953112) |
---|
Ki | 2.8±n/a nM |
---|
Citation | Georgiadis, D; Yiotakis, A Specific targeting of metzincin family members with small-molecule inhibitors: progress toward a multifarious challenge. Bioorg Med Chem16:8781-94 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Disintegrin and metalloproteinase domain-containing protein 17 |
---|
Name: | Disintegrin and metalloproteinase domain-containing protein 17 |
Synonyms: | A disintegrin and metalloproteinase domain 17 | ADA17_PIG | ADAM 17 | ADAM17 | Snake venom-like protease | TACE | TNF-alpha-Converting Enzyme |
Type: | Metalloprotease |
Mol. Mass.: | 12197.99 |
Organism: | Sus scrofa (pig) |
Description: | Partially purified TACE was obtained from porcine spleen. |
Residue: | 112 |
Sequence: | MLREQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPIGK
KNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
|
|
|
BDBM50265114 |
---|
n/a |
---|
Name | BDBM50265114 |
Synonyms: | CHEMBL495502 | N-((2R,6S)-4-(2-(hydroxyamino)-2-oxoethyl)-2,6-dimethylpiperidin-4-yl)-4-((2-methylquinolin-4-yl)methoxy)benzamide |
Type | Small organic molecule |
Emp. Form. | C27H32N4O4 |
Mol. Mass. | 476.5674 |
SMILES | C[C@H]1C[C@](CC(=O)NO)(C[C@@H](C)N1)NC(=O)c1ccc(OCc2cc(C)nc3ccccc23)cc1 |r| |
Structure |
|