| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A3 |
|---|
| Ligand | BDBM50170135 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_559972 (CHEMBL1014571) |
|---|
| Ki | 99±n/a nM |
|---|
| Citation |  Baraldi, PG; Preti, D; Tabrizi, MA; Romagnoli, R; Saponaro, G; Baraldi, S; Botta, M; Bernardini, C; Tafi, A; Tuccinardi, T; Martinelli, A; Varani, K; Borea, PA Structure-activity relationship studies of a new series of imidazo[2,1-f]purinones as potent and selective A(3) adenosine receptor antagonists. Bioorg Med Chem16:10281-94 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A3 |
|---|
| Name: | Adenosine receptor A3 |
|---|
| Synonyms: | A3 adenosine receptor (hA3) | AA3R_HUMAN | ADORA3 | Adenosine A3 receptor (A3AR) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36197.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P0DMS8 |
|---|
| Residue: | 318 |
|---|
| Sequence: | MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
|
|
|
|---|
| BDBM50170135 |
|---|
| n/a |
|---|
| Name | BDBM50170135 |
|---|
| Synonyms: | 1-Benzyl-7-tert-butyl-3-propyl-1H,8H-imidazo[2,1-f]purine-2,4-dione | 1-benzyl-7-tert-butyl-3-propyl-1H-imidazo[1,2-a]purine-2,4(3H,8H)-dione | CHEMBL191421 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H25N5O2 |
|---|
| Mol. Mass. | 379.4555 |
|---|
| SMILES | CCCn1c(=O)n(Cc2ccccc2)c2nc3[nH]c(cn3c2c1=O)C(C)(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
