| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50125099 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_494303 (CHEMBL938635) |
|---|
| Ki | 0.47±n/a nM |
|---|
| Citation |  Holl, R; Schepmann, D; Grünert, R; Bednarski, PJ; Wünsch, B Relationships between the structure of 6-allyl-6,8-diazabicyclo[3.2.2]nonane derivatives and their sigma receptor affinity and cytotoxic activity. Bioorg Med Chem17:777-93 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50125099 |
|---|
| n/a |
|---|
| Name | BDBM50125099 |
|---|
| Synonyms: | 1-Benzyl-4-(4-methoxy-benzyl)-piperazine | 1-benzyl-4-(4-methoxybenzyl)piperazine | CHEMBL163876 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H24N2O |
|---|
| Mol. Mass. | 296.4067 |
|---|
| SMILES | COc1ccc(CN2CCN(Cc3ccccc3)CC2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
