Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50281880 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_159632 |
---|
Ki | 9000±n/a nM |
---|
Citation | Vaillancourt, M; Vanasse, B; Cohen, E; Sauv, G Difunctional enols of N-protected amino acids as low molecular weight and novel inhibitors of HIV-1 protease. Bioorg Med Chem Lett3:1169-1174 (1993) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50281880 |
---|
n/a |
---|
Name | BDBM50281880 |
Synonyms: | 2-Acetylamino-4-methyl-pentanoic acid [(E)-(S)-1-benzyl-3-cyano-2-hydroxy-3-(4-nitro-phenyl)-allyl]-amide | CHEMBL17065 |
Type | Small organic molecule |
Emp. Form. | C25H28N4O5 |
Mol. Mass. | 464.5136 |
SMILES | CC(C)CC(NC(C)=O)C(=O)NC(Cc1ccccc1)C(=[OH+])C(=C=[N-])c1ccc(cc1)[N+]([O-])=O |
Structure |
|