Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Subtilisin BL |
---|
Ligand | BDBM50282564 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_197707 (CHEMBL801819) |
---|
Ki | 9200±n/a nM |
---|
Citation | Stabile, MR; Lai, WG; DeSantis, G; Gold, M; Jones, JB; Mitchinson, C; Bott, RR; Graycar, TP; Liu, CC Probing the specificity of the S1 binding site of M222 mutants of subtilisin B. lentus with boronic acid inhibitors Bioorg Med Chem Lett6:2501-2506 (1996) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Subtilisin BL |
---|
Name: | Subtilisin BL |
Synonyms: | SUBB_LEDLE | Subtilisin |
Type: | PROTEIN |
Mol. Mass.: | 26829.89 |
Organism: | Bacillus lentus |
Description: | ChEMBL_197707 |
Residue: | 269 |
Sequence: | AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGN
GHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGADGRGAISSIAQGLEWAGNNGMHVA
NLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGASSISYPARYANAMAVGATDQNNNR
ASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQI
RNHLKNTATSLGSTNLYGSGLVNAEAATR
|
|
|
BDBM50282564 |
---|
n/a |
---|
Name | BDBM50282564 |
Synonyms: | 2,4-Dichlorophenyl boronic acid | 2,4-dichloro benzene boronic acid | Boronic acid derivative | CHEMBL20726 |
Type | Small organic molecule |
Emp. Form. | C6H5BCl2O2 |
Mol. Mass. | 190.82 |
SMILES | OB(O)c1ccc(Cl)cc1Cl |
Structure |
|