Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Macrophage migration inhibitory factor |
---|
Ligand | BDBM50298005 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_585089 (CHEMBL1054355) |
---|
IC50 | 60000±n/a nM |
---|
Citation | Balachandran, S; Rodge, A; Gadekar, PK; Yadav, VN; Kamath, D; Chetrapal-Kunwar, A; Bhatt, P; Srinivasan, S; Sharma, S; Vishwakarma, RA; Dagia, NM Novel derivatives of ISO-1 as potent inhibitors of MIF biological function. Bioorg Med Chem Lett19:4773-6 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Macrophage migration inhibitory factor |
---|
Name: | Macrophage migration inhibitory factor |
Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
Type: | Enzyme |
Mol. Mass.: | 12478.18 |
Organism: | Homo sapiens (Human) |
Description: | P14174 |
Residue: | 115 |
Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
BDBM50298005 |
---|
n/a |
---|
Name | BDBM50298005 |
Synonyms: | 2-fluoro-4-(5-(5-methyl-1,2,4-oxadiazol-3-yl)-4,5-dihydroisoxazol-3-yl)phenol | CHEMBL565030 |
Type | Small organic molecule |
Emp. Form. | C12H10FN3O3 |
Mol. Mass. | 263.2245 |
SMILES | Cc1nc(no1)C1CC(=NO1)c1ccc(O)c(F)c1 |c:9| |
Structure |
|