| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Macrophage migration inhibitory factor |
|---|
| Ligand | BDBM50298026 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_585090 (CHEMBL1054356) |
|---|
| IC50 | 55000±n/a nM |
|---|
| Citation |  Balachandran, S; Rodge, A; Gadekar, PK; Yadav, VN; Kamath, D; Chetrapal-Kunwar, A; Bhatt, P; Srinivasan, S; Sharma, S; Vishwakarma, RA; Dagia, NM Novel derivatives of ISO-1 as potent inhibitors of MIF biological function. Bioorg Med Chem Lett19:4773-6 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Macrophage migration inhibitory factor |
|---|
| Name: | Macrophage migration inhibitory factor |
|---|
| Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 12478.18 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14174 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
|---|
| BDBM50298026 |
|---|
| n/a |
|---|
| Name | BDBM50298026 |
|---|
| Synonyms: | 3-((3-(3-fluoro-4-methoxyphenyl)-4,5-dihydroisoxazol-5-yl)methyl)-5-(trifluoromethyl)-1,2,4-oxadiazole | CHEMBL554783 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H11F4N3O3 |
|---|
| Mol. Mass. | 345.2491 |
|---|
| SMILES | COc1ccc(cc1F)C1=NOC(Cc2noc(n2)C(F)(F)F)C1 |t:10| |
|---|
| Structure | 
|
|---|
Search and Browse
