| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50172868 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_626925 (CHEMBL1114520) |
|---|
| IC50 | 1000±n/a nM |
|---|
| Citation |  Toussaint, M; Mousset, D; Foulon, C; Jacquemard, U; Vaccher, C; Melnyk, P Sigma-1 ligands: Tic-hydantoin as a key pharmacophore. Eur J Med Chem45:256-63 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50172868 |
|---|
| n/a |
|---|
| Name | BDBM50172868 |
|---|
| Synonyms: | (S)-2-(3-(benzyl(methyl)amino)propyl)-10,10a-dihydroimidazo[1,5-b]isoquinoline-1,3(2H,5H)-dione | (S)-2-[3-(Benzyl-methyl-amino)-propyl]-10,10a-dihydro-5H-imidazo[1,5-b]isoquinoline-1,3-dione | CHEMBL1089752 | CHEMBL365754 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H25N3O2 |
|---|
| Mol. Mass. | 363.4528 |
|---|
| SMILES | CN(CCCn1c(O)c2Cc3ccccc3Cn2c1=O)Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
