Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP3 subtype |
---|
Ligand | BDBM50317900 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_630199 (CHEMBL1117302) |
---|
Ki | 0.85±n/a nM |
---|
Citation | Asada, M; Obitsu, T; Kinoshita, A; Nagase, T; Yoshida, T; Yamaura, Y; Takizawa, H; Yoshikawa, K; Sato, K; Narita, M; Nakai, H; Toda, M; Tobe, Y 3-(2-Aminocarbonylphenyl)propanoic acid analogs as potent and selective EP3 receptor antagonists. Part 3: Synthesis, metabolic stability, and biological evaluation of optically active analogs. Bioorg Med Chem18:3212-23 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor EP3 subtype |
---|
Name: | Prostaglandin E2 receptor EP3 subtype |
Synonyms: | PE2R3_MOUSE | PGE receptor, EP3 isoform alpha | Prostaglandin E2 receptor EP3 isoform alpha | Prostaglandin E3 | Prostanoid EP3 receptor | Ptger3 | Ptgerep3 |
Type: | G-protein coupled receptor |
Mol. Mass.: | 40092.50 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 365 |
Sequence: | MASMWAPEHSAEAHSNLSSTTDDCGSVSVAFPITMMVTGFVGNALAMLLVSRSYRRRESK
RKKSFLLCIGWLALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRLCTFFGLTMTVFGLS
SLLVASAMAVERALAIRAPHWYASHMKTRATPVLLGVWLSVLAFALLPVLGVGRYSVQWP
GTWCFISTGPAGNETDPAREPGSVAFASAFACLGLLALVVTFACNLATIKALVSRCRAKA
AVSQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQMSVEQCKTQMGKEKE
CNSFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRDHTNYASSSTSLPCPGSSALMWS
DQLER
|
|
|
BDBM50317900 |
---|
n/a |
---|
Name | BDBM50317900 |
Synonyms: | 3-[4-(3,5-Difluorophenoxy)-2-({[(1R)-1-(3,5-dimethylphenyl)-3-methylbutyl]amino}carbonyl)phenyl]propanoic acid | CHEMBL1095117 |
Type | Small organic molecule |
Emp. Form. | C29H31F2NO4 |
Mol. Mass. | 495.5575 |
SMILES | CC(C)C[C@@H](NC(=O)c1cc(Oc2cc(F)cc(F)c2)ccc1CCC(O)=O)c1cc(C)cc(C)c1 |r| |
Structure |
|