| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HTH-type transcriptional regulator ExsA |
|---|
| Ligand | BDBM50319091 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_635525 (CHEMBL1118108) |
|---|
| IC50 | 13000±n/a nM |
|---|
| Citation |  Grier, MC; Garrity-Ryan, LK; Bartlett, VJ; Klausner, KA; Donovan, PJ; Dudley, C; Alekshun, MN; Tanaka, SK; Draper, MP; Levy, SB; Kim, OK N-Hydroxybenzimidazole inhibitors of ExsA MAR transcription factor in Pseudomonas aeruginosa: In vitro anti-virulence activity and metabolic stability. Bioorg Med Chem Lett20:3380-3 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HTH-type transcriptional regulator ExsA |
|---|
| Name: | HTH-type transcriptional regulator ExsA |
|---|
| Synonyms: | EXSA_PSEAE | Exoenzyme S synthesis regulatory protein exsA | exsA |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 31648.37 |
|---|
| Organism: | Pseudomonas aeruginosa |
|---|
| Description: | ChEMBL_635526 |
|---|
| Residue: | 278 |
|---|
| Sequence: | MQGAKSLGRKQITSCHWNIPTFEYRVNKEEGVYVLLEGELTVQDIDSTFCLAPGELLFVR
RGSYVVSTKGKDSRILWIPLSAQFLQGFVQRFGALLSEVERCDEPVPGIIAFAATPLLAG
CVKGLKELLVHEHPPMLACLKIEELLMLFAFSPQGPLLMSVLRQLSNRHVERLQLFMEKH
YLNEWKLSDFSREFGMGLTTFKELFGSVYGVSPRAWISERRILYAHQLLLNSDMSIVDIA
MEAGFSSQSYFTQSYRRRFGCTPSRSRQGKDECRAKNN
|
|
|
|---|
| BDBM50319091 |
|---|
| n/a |
|---|
| Name | BDBM50319091 |
|---|
| Synonyms: | (E)-3-(4-acetylphenyl)-N-(4-(6-cyano-1-hydroxy-1H-benzo[d]imidazol-2-yl)phenyl)acrylamide | CHEMBL1085360 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H18N4O3 |
|---|
| Mol. Mass. | 422.4354 |
|---|
| SMILES | CC(=O)c1ccc(C=CC(=O)Nc2ccc(cc2)-c2nc3ccc(cc3n2O)C#N)cc1 |w:8.8| |
|---|
| Structure | 
|
|---|
Search and Browse
