| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Urotensin-2 |
|---|
| Ligand | BDBM50302272 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_636756 (CHEMBL1167045) |
|---|
| Ki | 4±n/a nM |
|---|
| Citation |  Maryanoff, BE; Kinney, WA Urotensin-II receptor modulators as potential drugs. J Med Chem53:2695-708 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Urotensin-2 |
|---|
| Name: | Urotensin-2 |
|---|
| Synonyms: | UTS2 | UTS2_MACMU |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 14171.24 |
|---|
| Organism: | Macaca mulatta |
|---|
| Description: | ChEMBL_636756 |
|---|
| Residue: | 125 |
|---|
| Sequence: | MYKLASCCLLFIGFLNPLFSLPLLDSGEVSLQLSAPHEDAPLTSEELERASLLQILPEML
LGAERGDSLRKADSSTNIFNPRGNLRKFQDFSGQDPDILLSHLLARIRKPYKKRETPDCF
WKYCV
|
|
|
|---|
| BDBM50302272 |
|---|
| n/a |
|---|
| Name | BDBM50302272 |
|---|
| Synonyms: | 1-(2-(4-benzyl-4-hydroxypiperidin-1-yl)ethyl)-3-(2-methylquinolin-4-yl)urea | ACT-058362 | CHEMBL1164032 | CHEMBL567303 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H30N4O2 |
|---|
| Mol. Mass. | 418.5313 |
|---|
| SMILES | Cc1cc(NC(=O)NCCN2CCC(O)(Cc3ccccc3)CC2)c2ccccc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
