| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Metallo-beta-lactamase L1 type 3 |
|---|
| Ligand | BDBM50322613 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_641774 (CHEMBL1177097) |
|---|
| Ki | 4000±n/a nM |
|---|
| Citation |  Lassaux, P; Hamel, M; Gulea, M; Delbrück, H; Mercuri, PS; Horsfall, L; Dehareng, D; Kupper, M; Frère, JM; Hoffmann, K; Galleni, M; Bebrone, C Mercaptophosphonate compounds as broad-spectrum inhibitors of the metallo-beta-lactamases. J Med Chem53:4862-76 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Metallo-beta-lactamase L1 type 3 |
|---|
| Name: | Metallo-beta-lactamase L1 type 3 |
|---|
| Synonyms: | BLA1_STEMA | Beta-lactamase L1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 30803.13 |
|---|
| Organism: | Stenotrophomonas maltophilia |
|---|
| Description: | ChEMBL_1500319 |
|---|
| Residue: | 290 |
|---|
| Sequence: | MRSTLLAFALAVALPAAHTSAAEVPLPQLRAYTVDASWLQPMAPLQIADHTWQIGTEDLT
ALLVQTPDGAVLLDGGMPQMASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRR
TGAKVAANAESAVLLARGGSDDLHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMAG
HTPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLQGNPRYPHLIEDYRRSFATVRALPCD
VLLTPHPGASNWDYAAGARAGAKALTCKAYADAAEQKFDGQLAKETAGAR
|
|
|
|---|
| BDBM50322613 |
|---|
| n/a |
|---|
| Name | BDBM50322613 |
|---|
| Synonyms: | CHEMBL1173798 | alpha-Sulfanyl(2-methoxybenzyl)phosphonic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C8H11O4PS |
|---|
| Mol. Mass. | 234.209 |
|---|
| SMILES | COc1ccccc1C(=S)P(O)(O)O |
|---|
| Structure | 
|
|---|
Search and Browse
