Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Metallo-beta-lactamase L1 type 3 |
---|
Ligand | BDBM50322609 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_641775 (CHEMBL1177098) |
---|
Ki | 20000±n/a nM |
---|
Citation | Lassaux, P; Hamel, M; Gulea, M; Delbrück, H; Mercuri, PS; Horsfall, L; Dehareng, D; Kupper, M; Frère, JM; Hoffmann, K; Galleni, M; Bebrone, C Mercaptophosphonate compounds as broad-spectrum inhibitors of the metallo-beta-lactamases. J Med Chem53:4862-76 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Metallo-beta-lactamase L1 type 3 |
---|
Name: | Metallo-beta-lactamase L1 type 3 |
Synonyms: | BLA1_STEMA | Beta-lactamase L1 |
Type: | PROTEIN |
Mol. Mass.: | 30803.13 |
Organism: | Stenotrophomonas maltophilia |
Description: | ChEMBL_1500319 |
Residue: | 290 |
Sequence: | MRSTLLAFALAVALPAAHTSAAEVPLPQLRAYTVDASWLQPMAPLQIADHTWQIGTEDLT
ALLVQTPDGAVLLDGGMPQMASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRR
TGAKVAANAESAVLLARGGSDDLHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMAG
HTPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLQGNPRYPHLIEDYRRSFATVRALPCD
VLLTPHPGASNWDYAAGARAGAKALTCKAYADAAEQKFDGQLAKETAGAR
|
|
|
BDBM50322609 |
---|
n/a |
---|
Name | BDBM50322609 |
Synonyms: | CHEMBL1170023 | diisopropyl mercapto(phenyl)methylphosphonate |
Type | Small organic molecule |
Emp. Form. | C13H21O3PS |
Mol. Mass. | 288.343 |
SMILES | CC(C)OP(=O)(OC(C)C)C(S)c1ccccc1 |
Structure |
|