Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Macrophage migration inhibitory factor |
---|
Ligand | BDBM50327348 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_664389 (CHEMBL1259538) |
---|
IC50 | 7.5±n/a nM |
---|
Citation | Hare, AA; Leng, L; Gandavadi, S; Du, X; Cournia, Z; Bucala, R; Jorgensen, WL Optimization of N-benzyl-benzoxazol-2-ones as receptor antagonists of macrophage migration inhibitory factor (MIF). Bioorg Med Chem Lett20:5811-4 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Macrophage migration inhibitory factor |
---|
Name: | Macrophage migration inhibitory factor |
Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
Type: | Enzyme |
Mol. Mass.: | 12478.18 |
Organism: | Homo sapiens (Human) |
Description: | P14174 |
Residue: | 115 |
Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
BDBM50327348 |
---|
n/a |
---|
Name | BDBM50327348 |
Synonyms: | 3-(3-hydroxybenzyl)-6-methylbenzo[d]oxazol-2(3H)-one | CHEMBL1256233 |
Type | Small organic molecule |
Emp. Form. | C15H13NO3 |
Mol. Mass. | 255.2686 |
SMILES | Cc1ccc2n(Cc3cccc(O)c3)c(=O)oc2c1 |
Structure |
|