Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Apoptosis regulator Bcl-2 |
---|
Ligand | BDBM50329377 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_675633 (CHEMBL1273941) |
---|
Ki | 5200±n/a nM |
---|
Citation | Petros, AM; Huth, JR; Oost, T; Park, CM; Ding, H; Wang, X; Zhang, H; Nimmer, P; Mendoza, R; Sun, C; Mack, J; Walter, K; Dorwin, S; Gramling, E; Ladror, U; Rosenberg, SH; Elmore, SW; Fesik, SW; Hajduk, PJ Discovery of a potent and selective Bcl-2 inhibitor using SAR by NMR. Bioorg Med Chem Lett20:6587-91 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Apoptosis regulator Bcl-2 |
---|
Name: | Apoptosis regulator Bcl-2 |
Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
Type: | Homodimer or heterodimer |
Mol. Mass.: | 26269.11 |
Organism: | Homo sapiens (Human) |
Description: | P10415 |
Residue: | 239 |
Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
BDBM50329377 |
---|
n/a |
---|
Name | BDBM50329377 |
Synonyms: | 4'-((3-(4-(dimethylamino)-1-hydroxy-1-phenylbutyl)phenoxy)methyl)biphenyl-4-carboxylic acid | CHEMBL1270820 |
Type | Small organic molecule |
Emp. Form. | C32H33NO4 |
Mol. Mass. | 495.6087 |
SMILES | CN(C)CCCC(O)(c1ccccc1)c1cccc(OCc2ccc(cc2)-c2ccc(cc2)C(O)=O)c1 |
Structure |
|