Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | 5-hydroxytryptamine receptor 3A |
---|
Ligand | BDBM50329749 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_674333 (CHEMBL1274533) |
---|
Ki | 35.3±n/a nM |
---|
Citation | Yang, Z; Fairfax, DJ; Maeng, JH; Masih, L; Usyatinsky, A; Hassler, C; Isaacson, S; Fitzpatrick, K; DeOrazio, RJ; Chen, J; Harding, JP; Isherwood, M; Dobritsa, S; Christensen, KL; Wierschke, JD; Bliss, BI; Peterson, LH; Beer, CM; Cioffi, C; Lynch, M; Rennells, WM; Richards, JJ; Rust, T; Khmelnitsky, YL; Cohen, ML; Manning, DD Discovery of 2-substituted benzoxazole carboxamides as 5-HT3 receptor antagonists. Bioorg Med Chem Lett20:6538-41 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 3A |
---|
Name: | 5-hydroxytryptamine receptor 3A |
Synonyms: | 5-HT-3 | 5-HT3 | 5-HT3A | 5-HT3R | 5-hydroxytryptamine receptor 3 (5-HT3) | 5-hydroxytryptamine receptor 3A (5-HT3a) | 5-hydroxytryptamine receptor 3A (5HT3A) | 5HT3A_HUMAN | 5HT3R | HTR3 | HTR3A | Serotonin 3 (5-HT3) receptor | Serotonin 3 receptor (5HT3) | Serotonin receptor 3A | Serotonin-gated ion channel receptor | Serotonin-gated ion channel receptor 3 |
Type: | Protein |
Mol. Mass.: | 55283.27 |
Organism: | Homo sapiens (Human) |
Description: | P46098 |
Residue: | 478 |
Sequence: | MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTT
VSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDI
LINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLH
TIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRR
RPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAI
GTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQ
STSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ
ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA
|
|
|
BDBM50329749 |
---|
n/a |
---|
Name | BDBM50329749 |
Synonyms: | CHEMBL1271848 | endo-2-((2R,6S)-2,6-dimethylmorpholino)-N-((1R,5R)-9-methyl-9-azabicyclo[3.3.1]nonan-3-yl)benzo[d]oxazole-4-carboxamide |
Type | Small organic molecule |
Emp. Form. | C23H32N4O3 |
Mol. Mass. | 412.5252 |
SMILES | C[C@H]1CN(C[C@@H](C)O1)c1nc2c(cccc2o1)C(=O)NC1C[C@H]2CCC[C@H](C1)N2C |r,TLB:29:28:23.24.25:27.20.21| |
Structure |
|