| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-1 |
|---|
| Ligand | BDBM50337366 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_726540 (CHEMBL1685435) |
|---|
| Ki | 339±n/a nM |
|---|
| Citation |  Akritopoulou-Zanze, I; Wakefield, BD; Gasiecki, A; Kalvin, D; Johnson, EF; Kovar, P; Djuric, SW Scaffold oriented synthesis. Part 4: design, synthesis and biological evaluation of novel 5-substituted indazoles as potent and selective kinase inhibitors employing heterocycle forming and multicomponent reactions. Bioorg Med Chem Lett21:1480-3 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-1 |
|---|
| Name: | Serine/threonine-protein kinase pim-1 |
|---|
| Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 35681.82 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11309 |
|---|
| Residue: | 313 |
|---|
| Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
|---|
| BDBM50337366 |
|---|
| n/a |
|---|
| Name | BDBM50337366 |
|---|
| Synonyms: | 2-(1H-indazol-5-yl)-3-phenylimidazo[1,2-a]pyrimidine | CHEMBL1682541 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H13N5 |
|---|
| Mol. Mass. | 311.34 |
|---|
| SMILES | c1n[nH]c2ccc(cc12)-c1nc2ncccn2c1-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
