| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Placenta growth factor |
|---|
| Ligand | BDBM50339220 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_736105 (CHEMBL1692888) |
|---|
| IC50 | 100000±n/a nM |
|---|
| Citation |  Bower, KE; Lam, SN; Oates, BD; Del Rosario, JR; Corner, E; Osothprarop, TF; Kinhikar, AG; Hoye, JA; Preston, RR; Murphy, RE; Campbell, LA; Huang, H; Jimenez, J; Cao, X; Chen, G; Ainekulu, ZW; Datt, AB; Levin, NJ; Doppalapudi, VR; Pirie-Shepherd, SR; Bradshaw, C; Woodnutt, G; Lappe, RW Evolution of potent and stable placental-growth-factor-1-targeting CovX-bodies from phage display peptide discovery. J Med Chem54:1256-65 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Placenta growth factor |
|---|
| Name: | Placenta growth factor |
|---|
| Synonyms: | PGF | PGFL | PLGF | PLGF_HUMAN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 24794.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_942634 |
|---|
| Residue: | 221 |
|---|
| Sequence: | MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVD
VVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVEL
TFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWP
SSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR
|
|
|
|---|
| BDBM50339220 |
|---|
| n/a |
|---|
| Name | BDBM50339220 |
|---|
| Synonyms: | CHEMBL1689446 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C86H127N21O21S2 |
|---|
| Mol. Mass. | 1855.187 |
|---|
| SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(C)=O)[C@@H](C)CC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N2CCC[C@H]2C(=O)N[C@@H](Cc2cnc[nH]2)C(=O)N1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(N)=O)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
