| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM18070 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_764179 (CHEMBL1821390) |
|---|
| Ki | 0.081±n/a nM |
|---|
| Citation |  Li, X; Hilgers, M; Cunningham, M; Chen, Z; Trzoss, M; Zhang, J; Kohnen, L; Lam, T; Creighton, C; G C, K; Nelson, K; Kwan, B; Stidham, M; Brown-Driver, V; Shaw, KJ; Finn, J Structure-based design of new DHFR-based antibacterial agents: 7-aryl-2,4-diaminoquinazolines. Bioorg Med Chem Lett21:5171-6 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_STAAU | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase (DfrB) | Tetrahydrofolate dehydrogenase | folA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18249.71 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | n/a |
|---|
| Residue: | 159 |
|---|
| Sequence: | MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRN
VVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRG
DTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
|
|
|
|---|
| BDBM18070 |
|---|
| n/a |
|---|
| Name | BDBM18070 |
|---|
| Synonyms: | 5-[(2-cyclopropyl-7,8-dimethoxy-2H-chromen-5-yl)methyl]pyrimidine-2,4-diamine | AR-100 | Iclaprim |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H22N4O3 |
|---|
| Mol. Mass. | 354.403 |
|---|
| SMILES | COc1cc(Cc2cnc(N)nc2N)c2C=CC(Oc2c1OC)C1CC1 |c:16| |
|---|
| Structure | 
|
|---|
Search and Browse
